Skip to product information
1 of 1

ABclonal

Recombinant Human IL-12/IL-12A&IL-12B Protein - RP01232S

Recombinant Human IL-12/IL-12A&IL-12B Protein - RP01232S

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-12/IL-12A&IL-12B Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01232S-10, RP01232S-20, RP01232S-50, RP01232S-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)) of Human IL-12/IL-12A&IL-12B (Accession #) fused with a His tag at the C-terminus.

Alternate Names: CLMF, IL12, p70, Interleukin-12, IL12A, P35, NKSF

SWISS: P29459&P29460

GeneID: 3592&3593

Species: Human

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.94-3.75 ng/mL, corresponding to a specific activity of 2.67×10^5 ~1.06×10^6 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details