ABclonal
Recombinant Human IL-12/IL-12A&IL-12B Protein - RP01232S
Recombinant Human IL-12/IL-12A&IL-12B Protein - RP01232S
Couldn't load pickup availability
Recombinant Human IL-12/IL-12A&IL-12B Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01232S-10, RP01232S-20, RP01232S-50, RP01232S-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)) of Human IL-12/IL-12A&IL-12B (Accession #) fused with a His tag at the C-terminus.
Alternate Names: CLMF, IL12, p70, Interleukin-12, IL12A, P35, NKSF
SWISS: P29459&P29460
GeneID: 3592&3593
Species: Human
Purity: ≥ 95% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.94-3.75 ng/mL, corresponding to a specific activity of 2.67×10^5 ~1.06×10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
