Recombinant Human IL-12 R beta 1/CD212 Protein - RP00675

Recombinant Human IL-12 R beta 1/CD212 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00675-10, RP00675-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-12 R beta 1/CD212 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu540) of Human IL-12 R beta 1/CD212 (Accession #P42701) fused with an Fc tag at the C-terminus.

Alternate Names: IL12RB1, CD212, IL-12R-BETA1, IL12RB, IMD30

SWISS: P42701

GeneID: 3594

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin12 receptor subunit beta 1 (IL12RB1) is a type I transmembrane protein that belongs to thehemopoietin receptor superfamily. IL12RB1 can spontaneously form homodimers and -oligomers, which areable to bind IL12 with only low affinity. IL12 high affinity receptor complex is composed of two subunitsdesignated IL12RB1 and IL12RB2. While IL12RB1 interacts with the IL-12p40 subunit, IL-12p35 is mainlyconnecting with IL12RB2. This receptor chain is also responsible for transmitting the IL12 signal into the cell.IL12RB1, to the contrary, is also part of the IL23R, where it interacts with the p40 subunit of IL23. IL12RB1 isexpressed in activated T cells, NK cells and B cells.

Source: HEK293 cells

Tag: C-Fc

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only