ABclonal
Recombinant Human IL-12B/IL-12 p40 Protein - RP01288
Recombinant Human IL-12B/IL-12 p40 Protein - RP01288
Couldn't load pickup availability
Recombinant Human IL-12B/IL-12 p40 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01288-10, RP01288-20, RP01288-50, RP01288-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328) of human IL-12B/P40 (Accession #NP_002178.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
SWISS: P29460
GeneID: 3593
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human IL12B (Catalog: RP01288) at 5 μg/mL (100 μL/well) can bind Human IL12RB1 with a linear range of 0.02-2.7 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
