Skip to product information
1 of 1

ABclonal

Recombinant Human IL-12B/IL-12 p40 Protein - RP01288

Recombinant Human IL-12B/IL-12 p40 Protein - RP01288

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-12B/IL-12 p40 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01288-10, RP01288-20, RP01288-50, RP01288-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328) of human IL-12B/P40 (Accession #NP_002178.2) fused with a 6×His tag at the C-terminus.

Alternate Names: IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2

SWISS: P29460

GeneID: 3593

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human IL12B (Catalog: RP01288) at 5 μg/mL (100 μL/well) can bind Human IL12RB1 with a linear range of 0.02-2.7 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details