ABclonal
Recombinant Human IL-13 Protein - RP01320
Recombinant Human IL-13 Protein - RP01320
Couldn't load pickup availability
Recombinant Human IL-13 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01320-10, RP01320-20, RP01320-50, RP01320-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly35-Asn146) of Human IL13 (Accession #NP_002179.2) fused with an 6×His tag at the C-terminus.
Alternate Names: IL13, IL-13, P600
SWISS: P35225
GeneID: 3596
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin 13 (IL13) is also known as ALRH,and P600, is a single-chain glycosylated polypeptide, and is a cytokine critical in regulating inflammatory and immune responses. IL13 is secreted by many cell types, but especially by T helper type 2 (Th2) cells. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains.As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases. Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity. IL-13 protein and antibody are more importantly implicated as a central mediator of immunoregulatory processes in various cell types.
Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 1-4 ng/mL, corresponding to a specific activity of 0.25 × 10^6 ~1.0× 10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
