ABclonal
Recombinant Human IL-15 Protein - RP01236
Recombinant Human IL-15 Protein - RP01236
Couldn't load pickup availability
Recombinant Human IL-15 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01236-10, RP01236-20, RP01236-50, RP01236-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL15, IL-15
SWISS: P40933-1
GeneID: 3600
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.5-5 pg/mL, corresponding to a specific activity of 2.0×10^8 -6.67×10^8 units/mg.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
