Skip to product information
1 of 1

ABclonal

Recombinant Human IL-15 Protein - RP01236

Recombinant Human IL-15 Protein - RP01236

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-15 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01236-10, RP01236-20, RP01236-50, RP01236-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a 6×His tag at the C-terminus.

Alternate Names: IL15, IL-15

SWISS: P40933-1

GeneID: 3600

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.5-5 pg/mL, corresponding to a specific activity of 2.0×10^8 -6.67×10^8 units/mg.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details