ABclonal
Recombinant Human IL-15 Protein - RP01257
Recombinant Human IL-15 Protein - RP01257
Couldn't load pickup availability
Recombinant Human IL-15 Protein
Sizes: 10ug, 20ug, 100ug
Catalogue Numbers: RP01257-10, RP01257-20, RP01257-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: IL15, IL-15
SWISS: P40933-1
GeneID: 3600
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 2-8 ng/mL, corresponding to a specific activity of 1.25 × 10^5 ~5.0× 10^5 units/mg.|2.Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 24.29-97.14 ng/mL, corresponding to a specific activity of 1.03 × 10^4 ~4.12× 10^4 units/mg.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
