Skip to product information
1 of 1

ABclonal

Recombinant Human IL-15 Protein - RP01257

Recombinant Human IL-15 Protein - RP01257

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-15 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01257-10, RP01257-20, RP01257-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: IL15, IL-15

SWISS: P40933-1

GeneID: 3600

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 2-8 ng/mL, corresponding to a specific activity of 1.25 × 10^5 ~5.0× 10^5 units/mg.|2.Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 24.29-97.14 ng/mL, corresponding to a specific activity of 1.03 × 10^4 ~4.12× 10^4 units/mg.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details