WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL-15RA/CD215 Protein - RP01192

Recombinant Human IL-15RA/CD215 Protein - RP01192

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human IL-15RA/CD215 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01192-10, RP01192-20, RP01192-50, RP01192-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr205) of human IL-15R alpha/CD215 (Accession #NP_002180.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: IL15RA, CD215

SWISS: Q13261

GeneID: 3601

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL15 at 2 μg/mL (100 μL/well) can bind recombinant Human IL-15R alpha, the EC50 of Human IL-15R alpha is 178.9 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only