Recombinant Human IL-17A/CTLA-8 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00212-10, RP00212-20, RP00212-50, RP00212-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile20-Ala155) of human IL-17A (Accession #NP_002181.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17, interleukin-17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17
SWISS: Q16552
GeneID: 3605
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL17, also known as IL17a and CTLA8, is a is a 15-20 kDa glycosylated cytokine which belongs to the IL-17 family. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL17A promotes protective mucosal and epidermal inflammation in response to microbial infection.It induces chemokine production, neutrophil influx, and the production of antibacterial peptides.IL17A additionally enhances the production of inflammatory mediators by rheumatoid synovial fibroblasts and contributes to TNF alpha induced shock. In contrast, it can protect against the progression of colitis by limiting chronic inflammation. IL17A encourages the formation of autoreactive germinal centers and exacerbates the onset and progression of experimental models of autoimmunity.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant human IL17RA at 2 μg/mL (100 μL/well) can bind Recombinant human IL-17A, the EC50 of human IL-17A is 32.5-130 ng/mL.|2.Measured by its ability to induce IL-6 secretion by Hela cells. The ED50 for this effect is 2.64-10.58 ng/mL, corresponding to a specific activity of 9.45×10^4 ~3.79×10^5 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only