Skip to product information
1 of 1

Elabscience

Recombinant Human IL-17B protein(N-His)(active) - PKSH034105

Recombinant Human IL-17B protein(N-His)(active) - PKSH034105

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Human IL-17B protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034105-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-17B

Target Symptom: NIRF; Cytokine ZCYTO7

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q9UHF5

Accession: Q9UHF5

Background: Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells.

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 49 ng/mL.

Sequence: MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 21.26 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details