ABclonal
Recombinant Human IL-17F Protein - RP00870
Recombinant Human IL-17F Protein - RP00870
Couldn't load pickup availability
Recombinant Human IL-17F Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00870-10, RP00870-20, RP00870-50, RP00870-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-17F Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Gln163) of human IL-17F (Accession #Q96PD4) fused with a His tag at the N-terminus.
Alternate Names: IL17F, CANDF6, IL-17F, ML-1, ML1
SWISS: Q96PD4
GeneID: 112744
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells in the presense of 2 ng/mL TNFα(Catalog: RP01071). The ED50 for this effect is 3.51-14.04 ng/mL, corresponding to a specific activity of 7.12×10^4<
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
