ABclonal
Recombinant Human IL-19 Protein - RP01949
Recombinant Human IL-19 Protein - RP01949
Couldn't load pickup availability
Recombinant Human IL-19 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01949-10, RP01949-20, RP01949-50, RP01949-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala177)of Human IL-19 (Accession #NP_715639.2) fused with a His tag at the C-terminus.
Alternate Names: IL19, ZMDA1, Interleukin-19, IL-19, Melanoma differentiation-associated protein-like protein, NG.1
SWISS: Q9UHD0-1
GeneID: 29949
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The molecular features at the IL19 locus may modestly alter the establishment of HIV-1 infection. Interleukin (IL) 19, IL-20, and IL-24 belong to the IL-10 cytokine family and have been identified to play a role in the regulation of epidermal functions and inflammation. The expression of IL19 in biopsies of patients with active ulcerative colitis was increased compared with patients with quiescent ulcerative colitis and that colitis was attenuated in IL-19-deficient mice. The disruption of the epithelial barrier with dextran sodium sulfate leads to increased IL-19 expression. Attenuated colitis in IL-19-deficient animals was associated with reduced numbers of IL-6-producing macrophages in the inflamed colonic lamina propria. Microbial-driven expression of IL-19 by intestinal macrophages may contribute to the pathogenesis of inflammatory bowel disease.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
