Skip to product information
1 of 1

ABclonal

Recombinant Human IL-1R1/CD121a Protein - RP01036

Recombinant Human IL-1R1/CD121a Protein - RP01036

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-1R1/CD121a Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01036-10, RP01036-20, RP01036-50, RP01036-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-1R1/CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp21-Thr332) of human IL1R1 (Accession #NP_000868.1) fused with a 6×His tag at the C-terminus.

Alternate Names: IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80

SWISS: P14778

GeneID: 3554

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 1 receptor, type I (IL-1R1) also known as CD121a (Cluster of Differentiation 121a), is an interleukin receptor. The protein encoded by this gene is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA). The shape change and subsequent repair processes are IL-1β activity-dependent, acting through the IL-1 type 1 receptor (IL-1R1), as co-application of the IL-1type 1 receptor antagonist protein (IL-1ra) blocks IL-1β induced effects. This gene along with interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 2 (IL1RL2), and interleukin 1 receptor-like 1 (IL1RL1) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. It has been suggested that the Type II receptor, either as the membrane-bound or as the soluble form, serves as a decoy for IL-1 and inhibits IL-1 action by blocking the binding of IL-1 to the signaling Type I receptor complex. Recombinant IL-1 soluble receptor Type I is a potent antagonist of IL-1 action.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL1RA at 5 μg/mL (100 μL/well) can bind Recombinant Human IL1R1 with a linear range of 63-252 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human IL-1 beta (Catalog: RP00002) at 10 μg/mL (100 μL/well) can bind Biotinylated Human IL-1R1 (Catalog: RP01036) with a linear range of 0.002-1 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details