Skip to product information
1 of 1

ABclonal

Recombinant Human IL-20RA Protein - RP00537

Recombinant Human IL-20RA Protein - RP00537

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-20RA Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00537-10, RP00537-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-20RA/IL-20 R alpha Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val30-Lys250) of human IL-20RA/IL-20 R alpha (Accession #Q9UHF4) fused with a 6×His tag at the C-terminus.

Alternate Names: IL20RA, CRF2-8, IL-20R-alpha, IL-20R1, IL-20RA

SWISS: Q9UHF4

GeneID: 53832

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-20 Receptor Subunit α (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details