ABclonal
Recombinant Human IL-20RB Protein - RP01102
Recombinant Human IL-20RB Protein - RP01102
Couldn't load pickup availability
Recombinant Human IL-20RB Protein
Sizes: 10ug, 50ug
Catalogue Number: RP01102-10, RP01102-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-20RB Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp30-Ala230) of human IL-20RB (Accession #Q6UXL0) fused with an Fc tag at the C-terminus.
Alternate Names: IL20RB, DIRS1, FNDC6, IL-20R2
SWISS: Q6UXL0
GeneID: 53833
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).
Source: HEK293 cells
Tag: C-Fc
Formulation: Supplied as a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
