WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL-21 protein(N-His)(active) - PKSH034107

Recombinant Human IL-21 protein(N-His)(active) - PKSH034107

Regular price
$1,034.60
Regular price
Sale price
$1,034.60
Unit price
per 
Availability
Sold out

Recombinant Human IL-21 protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034107-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-21

Target Symptom: Za11

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: C-His

UNIProt ID: Q9HBE4

Accession: Q9HBE4

Background: IL-21 is a potent cytokine regulating many cell types of the immune system. IL-21 is produced by activated T follicular helper cells (Tfh), Th17 cells, and NKT cells. Tfh-derived IL-21 plays an important role in the development of humoral immunity through its autocrine effects on the Tfh cell and paracrine effects on immunoglobulin affinity maturation, plasma cell differentiation, and B cell memory responses. IL-21 protein regulates several aspects of T cell function. It co-stimulates the activation, proliferation, and survival of CD8+ T cells and NKT cells and promotes Th17 cell polarization. IL-21 blocks the generation of regulatory T cells and their suppressive effects on CD4+ T cells. In addition to its role in T cell biology, IL-21 also plays a critical role in B cell activation, proliferation, differentiation, and apoptosis. It is also required for the migration of dendritic cells to draining lymph nodes. And IL-21 suppresses cutaneous hypersensitivity reactions by limiting allergen-specific IgE production and mast cell degranulation. In the autoimmune disease Systemic lupus erythematosus (SLE), a link between IL-21 and SLE disease susceptibility and progression was recently reported.

Activity: Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is < 10 ng/mL.

Sequence: MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 15.4 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only