ABclonal
Recombinant Human IL-23/IL-12B&IL-23A Protein - RP01160
Recombinant Human IL-23/IL-12B&IL-23A Protein - RP01160
Couldn't load pickup availability
Recombinant Human IL-23/IL-12B&IL-23A Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01160-10, RP01160-20, RP01160-50, RP01160-100
Citations, Manuals and MSDS Available upon request.
Description: Active Recombinant Human IL-12B&IL-23A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328&Arg20-Pro189) of human IL-23 (Accession #NP_002178.2/NP_057668.1) fused with a 6×His tag at the N-terminus(IL23A).
Alternate Names: IL-23 p19/IL-12 p40, IL23, SGRF , IL-23 alpha & IL-12 beta
SWISS: P29460&Q9NPF7
GeneID: 3593&51561
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human IL-12B&IL-23A at 5μg/mL (100 μL/well) can bind Human IL23R with a linear range of 4-135 ng/ml.|2.Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED50 for this effect is 21.23-84.94 ng/mL, corresponding to a specific activity of 1.17×10^4 ~4.71×10^4 units/mg.
Source: HEK293 cells
Tag: No tag(IL12B)&N-his(IL23A)
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS//RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
