Recombinant human IL-25/IL-17E Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01755-10, RP01755-20, RP01755-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human IL-25/IL-17E Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr33-Gly177) of human IL-25(Accession #NP_073626.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL17E; IL-25
SWISS: Q9H293
GeneID: 64806
Species: human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17–producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. IL-25 promotes cell expansion and Th2 cytokine production when Th2 central memory cells are stimulated with thymic stromal lymphopoietin (TSLP)–activated dendritic cells (DCs), homeostatic cytokines, or T cell receptor for antigen triggering. Elevated expression of IL-25 and IL-25R transcripts was observed in asthmatic lung tissues and atopic dermatitis skin lesions, linking their possible roles with exacerbated allergic disorders. A plausible explanation that IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of adaptive Th2 memory cells had been provided.
Bio-Activity: Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 13.32-53.24 ng/mL, corresponding to a specific activity of 1.88×10^4 ~7.51×10^4 units/mg.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl,1 mM EDTA,pH8.0
Antigen Sequence: YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only