Recombinant Human IL-27/IL-27A&IL-27B Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00639-10, RP00639-20, RP00639-50, RP00639-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-27/IL-27A&IL-27B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Pro243＆Arg21-Lys229) of IL-27A (Accession #NP_663634.2) fused with a His tag at the N-terminus and IL-27B (Accession #NP_035692.2) fused with no Tag.
Alternate Names: IL27A&IL27B, Interleukin-27 subunit alpha&Interleukin-27 subunit beta, IL-27 subunit alpha&IL-27 subunit beta, IL-27A&IL-27B
SWISS: Q8NEV9&Q14213
GeneID: 246778＆10148
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL-27 protein is a member of the IL-6 superfamily, which is expressed on monocytes, endothelial cells, and dendritic cells. IL-27 protein is also referred to as the IL-12 p35-related protein, p28, is one subunit of a heterodimeric cytokine complex, and associates with another subunit EBI3 , and IL-12 p40-related protein (IL-27B). IL-27 protein is an early product of activated antigen-presenting cells and drives the rapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drives efficient adaptive immune response. IL-27 protein has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling. Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy.
Source: HEK293 cells
Tag: N-His＆NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: PRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP&RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only