ABclonal
Recombinant Human IL-2RG/CD132 Protein - RP01031
Recombinant Human IL-2RG/CD132 Protein - RP01031
Couldn't load pickup availability
Recombinant Human IL-2RG/CD132 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01031-10, RP01031-20, RP01031-50, RP01031-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of human CD132 (Accession #NP_000197.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
SWISS: P31785
GeneID: 3561
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The gamma chain of the high affinity functional human IL-2 receptor complex belongs to the hematopoietin receptor family. The common gamma chain (γc) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. IL2RG is a 369 amino acid residue protein consisting of a 22 residue signal sequence, a 232 residue extracellular domain, a 29 residue transmembrane domain and an 86 residue cytoplasmic domain. IL2RG is a cytokine receptor sub-unit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin-21 receptor. It has been proposed that IL2RG be designated the common gamma chain ( gamma c). The site of molecular defects in X-linked SCID (severe combined immunodeficiency) has now been mapped to the IL-2 R gamma gene.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
