Recombinant Human IL-36 beta/IL-1F8 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00020-10, RP00020-20, RP00020-50, RP00020-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-36 beta/IL-1F8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6×His tag at the C-terminus.
Alternate Names: FIL1, FIL1-(ETA), FIL1H, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2, IL36B
SWISS: Q9NZH7
GeneID: 27177
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-1 family member 8(IL1F8) also known as IL36B, is a member of the interleukin 1(IL-1) cytokine family. IL-36 beta is expressed by keratinocytes, naïve CD4+ T cells, neurons, and glia. It is up-regulated in keratinocytes and synovial fibroblasts by inflammatory stimulation and in psoriatic lesions. IL-36 beta promotes inflammatory responses by enhancing the activation and Th1 polarization of dendritic cells and T cells. It also enhances the production of multiple pro-inflammatory cytokines, chemokines, and anti-bacterial defensin peptides by keratinocytes, synovial fibroblasts, and articular chondrocytes. IL-1 family members exert their effects through binding to receptors that belong to the IL-1 receptor (IL-1R) family.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only