ABclonal
Recombinant Human IL-36Ra/IL-1F5 Protein - RP00030
Recombinant Human IL-36Ra/IL-1F5 Protein - RP00030
Couldn't load pickup availability
Recombinant Human IL-36Ra/IL-1F5 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00030-10, RP00030-20, RP00030-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Asp155) of human IL-36Ra (Accession #NP_036407.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL36RN, FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14
SWISS: Q9UBH0
GeneID: 26525
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-1 family member 5 (IL-1F5), also known as interleukin 36 receptor antagonist (IL36RA), is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). IL-1F5 is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). IL-1F5 could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), which is present in epithelial barriers and takes part in local inflammatory response. It has been proved that IL-1F5 induces IL-4 mRNA and protein expression in glia in vitro and enhances hippocampal expression of IL-4 following intracerebroventricular injection. The inhibitory effect of IL-1F5 on LPS-induced IL-1β is attenuated in cells from IL-4-defective mice.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
