Skip to product information
1 of 1

ABclonal

Recombinant Human IL-6 Protein - RP01688

Recombinant Human IL-6 Protein - RP01688

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-6 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01688-10, RP01688-20, RP01688-50, RP01688-100

Citations, Manuals and MSDS Available upon request.

Description: Active Recombinant Human IL6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with no additional amino acid.

Alternate Names: CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2

SWISS: P05231

GeneID: 3569

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-6 is a multifunctional α-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions.It is secreted by T cells, macrophages , monocytes, fibroblasts,endothelial cells,et.al. to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation.Interleukin 6 has been shown to interact with interleukin-6 receptor and glycoprotein. IL-6 is relevant to many disease processes such as diabetes,atherosclerosis, depression,Alzheimer's Disease,systemic,lupus erythematosus,prostate cancer and rheumatoid arthritis.

Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.12-0.47 ng/mL.

Source: HEK293 cells

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details