ABclonal
Recombinant Human IL-6RA/CD126 Protein - RP01396
Recombinant Human IL-6RA/CD126 Protein - RP01396
Couldn't load pickup availability
Recombinant Human IL-6RA/CD126 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01396-10, RP01396-20, RP01396-50, RP01396-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp358) of human IL-6R alpha/CD126 (Accession #NP_000556.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: IL6R, CD126, IL-6R-1, IL-6RA, IL6Q, IL6RA, IL6RQ, gp80
SWISS: P08887
GeneID: 3570
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The soluble form of recombinant human IL6R consists of 357 amino acids with a molecular weight of 40 kDa. It migrates with an apparent molecular mass of 60-65 kDa due to glycosylation in SDS-PAGE under reducing conditions. Interleukin 6 receptor (IL-6R) also known as CD126 (Cluster of Differentiation 126) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL-6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL-6R protein are able to mediate IL-6 signals into the cells through the interaction of gp13. The resulting IL-6/sIL-6R protein complex is also capable of binding to gp13 and inducing intracellular signalling. Through this so-called "trans-signalling" mechanism, IL-6 is able to stimulate cells that lack an endogenous mIL-6R. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 1 μg/mL (100 μL/well) can bind Human IL6RA with a linear range of 1-5.4 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
