ABclonal
Recombinant Human IL-7 Protein - RP01040
Recombinant Human IL-7 Protein - RP01040
Couldn't load pickup availability
Recombinant Human IL-7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01040-10, RP01040-20, RP01040-50, RP01040-100
Citations, Manuals and MSDS Available upon request.
Description: Active Recombinant Human IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-His177) of human IL-7 (Accession #NP_000871.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL7, IL-7
SWISS: P13232-1
GeneID: 3574
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human IL7 at 2 μg/mL (100 μL/well) can bind human IL7R with a linear range of 0.97 -159.1 ng/mL.|2.Measured in a cell proliferation assay using IL-2(Catalog: RP01384)-activated mouse spleen cell. The ED50 for this effect is 0.1-0.4 ng/mL, corresponding to a specific activity of 2.5×10^6 ~1×10^7 units/mg.|3.Measured in a cell proliferation assay using murine 2E8 cells. The ED50 for this effect is 0.78-3.1ng/mL, corresponding to a specific activity of 3.23×10^5 ~1.28×10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
