Skip to product information
1 of 1

ABclonal

Recombinant Human IL-9 Protein - RP01686

Recombinant Human IL-9 Protein - RP01686

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-9 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01686-10, RP01686-20, RP01686-50, RP01686-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: P40; HP40; IL-9; IL9

SWISS: P15248

GeneID: 3578

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.

Bio-Activity: Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. Avanzi, G. et al. (1988) Br. J. Haematol. 69:359. The ED50 for this effect is 0.48-1.91 ng/mL.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details