Skip to product information
1 of 1

Elabscience

Recombinant Human IL-9 protein(N-His)(active) - PKSH034101

Recombinant Human IL-9 protein(N-His)(active) - PKSH034101

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Human IL-9 protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034101-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-9

Target Symptom: p40 cytokine; T-cell growth factor p40

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P15248

Accession: P15248

Background: Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Activity: Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately > 5 x106 IU/ mg.

Sequence: MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.01 EU per μg of the protein as determined by the LAL method.

Calculated MW: 16.73 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details