Recombinant Human IL1RL1/ST2 Protein
Sizes: 10ug, 20ug, 50ug, 100ug, 200ug
Catalogue Numbers: RP00271-10, RP00271-20, RP00271-50, RP00271-100, RP00271-200
Citations, Manuals and MSDS Available upon request.
Recombinant Human IL1RL1/ST2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys19-Phe328) of human ST2 (Accession #NP_003847.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
SWISS: Q01638-2
GeneID: 9173
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL33 at 10 μg/mL (100 μL/well) can bind Recombinant Human ST2 with a linear range of 1.41-5.64 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only