WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL1RL1/ST2 Protein - RP00271

Recombinant Human IL1RL1/ST2 Protein - RP00271

Regular price
$140.00
Regular price
Sale price
$140.00
Unit price
per 
Availability
Sold out

Recombinant Human IL1RL1/ST2 Protein

Sizes: 10ug, 20ug, 50ug, 100ug, 200ug

Catalogue Numbers: RP00271-10, RP00271-20, RP00271-50, RP00271-100, RP00271-200

Citations, Manuals and MSDS Available upon request.

Recombinant Human IL1RL1/ST2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys19-Phe328) of human ST2 (Accession #NP_003847.2) fused with a 6×His tag at the C-terminus.

Alternate Names: IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1

SWISS: Q01638-2

GeneID: 9173

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL33 at 10 μg/mL (100 μL/well) can bind Recombinant Human ST2 with a linear range of 1.41-5.64 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only