ABclonal
Recombinant Human Inhibin beta E/INHBE Protein - RP03275
Recombinant Human Inhibin beta E/INHBE Protein - RP03275
Couldn't load pickup availability
Recombinant Human Inhibin beta E/INHBE Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP03275-20, RP03275-50, RP03275-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Inhibin beta E/INHBE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr237-Ser350) of human Inhibin beta E/INHBE (Accession #NP_113667.1) fused with hFc tag at the N-terminus.
Alternate Names: INHBE, Inhibin beta E chain, Activin beta-E chain
SWISS: P58166
GeneID: 83729
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.
Source: HEK293 cells
Tag: N-hFC
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
