Skip to product information
1 of 1

ABclonal

Recombinant Human Inhibin beta E/INHBE Protein - RP03275

Recombinant Human Inhibin beta E/INHBE Protein - RP03275

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Inhibin beta E/INHBE Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP03275-20, RP03275-50, RP03275-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Inhibin beta E/INHBE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr237-Ser350) of human Inhibin beta E/INHBE (Accession #NP_113667.1) fused with hFc tag at the N-terminus.

Alternate Names: INHBE, Inhibin beta E chain, Activin beta-E chain

SWISS: P58166

GeneID: 83729

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.

Source: HEK293 cells

Tag: N-hFC

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details