ABclonal
Recombinant Human Insulin-like 3/INSL3 Protein - RP00915
Recombinant Human Insulin-like 3/INSL3 Protein - RP00915
Couldn't load pickup availability
Recombinant Human Insulin-like 3/INSL3 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00915-10, RP00915-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Insulin-like 3/INSL3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu21-Tyr131) of human INSL3/Insulin-like 3 (Accession #P51460) fused with a 6×His tag at the C-terminus.
Alternate Names: INSL3, RLF, RLNL, ley-I-L
SWISS: P51460
GeneID: 3640
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-6×His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
