Skip to product information
1 of 1

ABclonal

Recombinant Human Insulin-like 3/INSL3 Protein - RP00915

Recombinant Human Insulin-like 3/INSL3 Protein - RP00915

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Insulin-like 3/INSL3 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00915-10, RP00915-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Insulin-like 3/INSL3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu21-Tyr131) of human INSL3/Insulin-like 3 (Accession #P51460) fused with a 6×His tag at the C-terminus.

Alternate Names: INSL3, RLF, RLNL, ley-I-L

SWISS: P51460

GeneID: 3640

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-6×His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details