Recombinant Human Interferon omega-1/IFNW1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01752-10, RP01752-20, RP01752-50, RP01752-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Interferon omega-1/IFNW1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser195) of human Interferon omega-1/IFNW1 (Accession #NP_002168.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Interferon omega-1; IFNW1
SWISS: P05000
GeneID: 3467
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IFNs are a large family of proteins having antiviral, antiproliferative, and immunomodulatory effects, and are divided into two major classes, type I and type II, based on differences in receptor binding and nucleotide sequence. Type I IFNs consist of IFN α, β, τ, and ω and bind to the type I IFN receptor, whereas IFN-γ is the only type II IFN and is specific for the type II IFN receptor. Human IFN-ω, was identified by three independent groups in 1985 and is structurally related to IFN-α and -β. Both human IFN-ω and IFN-α are produced by virally induced leukocytes and have similar antiviral activities on human cell lines, and a sizeable proportion (at least 1%) of the total antiviral activity of leukocyte IFN is contributed by IFN-ωl. Also, it was reported that IFN-ω could inhibit the growth of human tumors in vivo.
Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.13-0.54 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only