Skip to product information
1 of 1

ABclonal

Recombinant Human Intrinsic factor/CBLIF Protein - RP02842

Recombinant Human Intrinsic factor/CBLIF Protein - RP02842

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Intrinsic factor/CBLIF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02842-10, RP02842-20, RP02842-50, RP02842-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Intrinsic factor/CBLIF Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ser19-Tyr417) of human Intrinsic factor/CBLIF (Accession #NP_005133.2) fused with a 6×His tag at the C-terminus.

Alternate Names: Cobalamin binding intrinsic factor; IF; GIF; INF; IFMH; TCN3; CBLIF

SWISS: P27352-1

GeneID: 2694

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Gastric intrinsic factor, also known as GIF, belongs to the of the cobalamin transport protein family. It is a glycoprotein produced by the parietal cells of the stomach. Gastric intrinsic factor plays a key role in the absorption of vitamin B12 on in the small intestine. Vitamin B12 bounds to haptocorrin after entry into the stomach. The resulting complex enters the duodenum, where pancreatic enzymes digest haptocorrin. In the less acidic environment of the small intestine, B12 can then bind to gastric intrinsic factor. This new complex travels to the ileum, where special epithelial cells endocytose them. Inside the cell, B12 dissociates once again and binds to another protein, transcobalamin II. The new complex can exit the epithelial cells to enter the liver.

Source: HEK293 Cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details