WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein - RP01963

Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein - RP01963

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01963-10, RP01963-20, RP01963-50, RP01963-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His25-103Gly) of Human ITPRIPL1/KIAA1754L/CD3L1 (Accession #NP_001008949.1) fused with a His tag at the C-terminus.

Alternate Names: ITPRIPL1, KIAA1754L, Inositol 1, 4, 5-trisphosphate receptor-interacting protein-like 1

SWISS: Q6GPH6

GeneID: 150771

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: ITPRIPL1/KIAA1754L/CD3L1 is a transmembrane protein with broad expression in the testis associated with immune evasion. In fact, ITPRIPL1 is a molecule specifically expressed in immune privileged tissues, “hot” tumors without PD-L1 expression, and non-responding tumors to PD-1 blockade therapy. ITPRIPL1 has been shown to impair T cell function in vitro and in vivo through CD3e with experimental evidence supporting a negative correlation between ITPRIPL1 expression level in antigen-presenting cells and T cell cytotoxicity. ITPRIPL1 was a hypermethylated-low expression gene in breast cancer and acted as an independent biomarker for the prognosis of lung adenocarcinoma by using bioinformatics methods. Thus, targeting the ITPRIPL1-CD3e axis, especially in PD-1 - PD-L1 negative patients, is a promising therapeutic strategy to reduce immune evasion.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only