Skip to product information
1 of 1

ABclonal

Recombinant Human Jagged1/JAG1/CD339 Protein - RP00877

Recombinant Human Jagged1/JAG1/CD339 Protein - RP00877

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Jagged1/JAG1/CD339 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00877-10, RP00877-20, RP00877-50, RP00877-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Jagged1/JAG1/CD339 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Trp896-Arg1065) of human Jagged-1/JAG1 (Accession #P78504) fused with an Fc tag at the C-terminus.

Alternate Names: JAG1, AGS, AGS1, AHD, AWS, CD339, HJ1, JAGL1, jagged 1

SWISS: P78504

GeneID: 182

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: WCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNR

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details