Recombinant Human Jagged1/JAG1/CD339 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00877-10, RP00877-20, RP00877-50, RP00877-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Jagged1/JAG1/CD339 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Trp896-Arg1065) of human Jagged-1/JAG1 (Accession #P78504) fused with an Fc tag at the C-terminus.
Alternate Names: JAG1, AGS, AGS1, AHD, AWS, CD339, HJ1, JAGL1, jagged 1
SWISS: P78504
GeneID: 182
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: WCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNR
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only