Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00170-10, RP00170-20, RP00170-50, RP00170-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Asn241 (Ala149Pro)) of human JAM3/JAM-C (Accession #NP_116190.3) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: JAM3, JAM-2, JAM-3, JAM-C, JAMC
SWISS: Q9BX67
GeneID: 83700
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKPVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only