ABclonal
Recombinant Human Kallikrein-8/KLK8 Protein - RP00226
Recombinant Human Kallikrein-8/KLK8 Protein - RP00226
Couldn't load pickup availability
Recombinant Human Kallikrein-8/KLK8 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00226-10, RP00226-20, RP00226-50, RP00226-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Kallikrein-8/KLK8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly260) of human KLK-8/Kallikrein-8 (Accession #NP_009127.1) fused with a 6×His tag at the C-terminus.
Alternate Names: KLK8, HNP, NP, NRPN, PRSS19, TADG14, kallikrein-8, Kallikrein 8, HNP, NP, NRPN, PRSS19, TADG14
SWISS: O60259
GeneID: 11202
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Kallikrein-8, also known as Neuropsin, Serine protease 19, Serine protease TADG-14, Tumor-associated differentially expressed gene 14 protein and KLK8, is a secreted protein which belongs to the peptidase S1 family and Kallikrein subfamily. It is a serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Kallikrein-8 / KLK8 is involved in skin desquamation and keratinocyte proliferation and plays a role in the secondary phase of pathogenesis following spinal cord injury. Kallikrein-8 / KLK8 is expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
