Skip to product information
1 of 1

ABclonal

Recombinant Human KLRG1/CLEC15A/CD369 Protein - RP01521

Recombinant Human KLRG1/CLEC15A/CD369 Protein - RP01521

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human KLRG1/CLEC15A/CD369 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01521-10, RP01521-20, RP01521-50, RP01521-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human KLRG1/CLEC15A/CD369 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu60-Phe195) of human KLRG1/CLEC15A/CD369 (Accession #NP_001316028.1) fused with a raFc tag at the N-terminus.

Alternate Names: 2F1, MAFA, MAFA-L, CLEC15A, MAFA-2F1, MAFA-LIKE, KLRG1

SWISS: Q96E93

GeneID: 10219

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: KLRG1 (killer cell lectin?like receptor G1), also called MAFA (mast cell function associated), is an inhibitory type II transmembrane glycoprotein of the C?type lectin family, designated CLEC15A.Within the ECD, Human KLRG1 shares 57% and 80% aa sequence identity with mouse and rat KLRG1, respectively.KLRG1 is expressed on subpopulations of CD8+, CD4+, regulatory, and gamma/delta T cells as well as on NK cells. KLRG1 is expressed on T cells found in cord blood, but it is down?regulated postnatally and is subsequently re?expressed on antigen?exposed T cells. It is expressed by a greater proportion of CD8+ T cells in the elderly and by virus?specific CD8+ T cells during chronic virus infection. KLRG1 binds to E-, N-, and R-Cadherins, triggering ITIM?dependent KLRG1 signaling and inhibition of T cell activation. The response is bi?directional, as KLRG1 binding to E?Cadherin on dendritic cells (DC) can induce an anti?inflammatory DC phenotype (increased IL?10 production and decreased IL?6 and TNF? alpha production).

Source: HEK293 cells

Tag: N-Rabbit Fc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details