Recombinant Human KLRG1/CLEC15A/CD369 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01521-10, RP01521-20, RP01521-50, RP01521-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human KLRG1/CLEC15A/CD369 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu60-Phe195) of human KLRG1/CLEC15A/CD369 (Accession #NP_001316028.1) fused with a raFc tag at the N-terminus.
Alternate Names: 2F1, MAFA, MAFA-L, CLEC15A, MAFA-2F1, MAFA-LIKE, KLRG1
SWISS: Q96E93
GeneID: 10219
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: KLRG1 (killer cell lectin?like receptor G1), also called MAFA (mast cell function associated), is an inhibitory type II transmembrane glycoprotein of the C?type lectin family, designated CLEC15A.Within the ECD, Human KLRG1 shares 57% and 80% aa sequence identity with mouse and rat KLRG1, respectively.KLRG1 is expressed on subpopulations of CD8+, CD4+, regulatory, and gamma/delta T cells as well as on NK cells. KLRG1 is expressed on T cells found in cord blood, but it is down?regulated postnatally and is subsequently re?expressed on antigen?exposed T cells. It is expressed by a greater proportion of CD8+ T cells in the elderly and by virus?specific CD8+ T cells during chronic virus infection. KLRG1 binds to E-, N-, and R-Cadherins, triggering ITIM?dependent KLRG1 signaling and inhibition of T cell activation. The response is bi?directional, as KLRG1 binding to E?Cadherin on dendritic cells (DC) can induce an anti?inflammatory DC phenotype (increased IL?10 production and decreased IL?6 and TNF? alpha production).
Source: HEK293 cells
Tag: N-Rabbit Fc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only