Skip to product information
1 of 1

ABclonal

Recombinant Human L-Selectin/SELL/CD62L Protein - RP00255

Recombinant Human L-Selectin/SELL/CD62L Protein - RP00255

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human L-Selectin/SELL/CD62L Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00255-20, RP00255-50, RP00255-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human L-Selectin/SELL/CD62L Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp52-Asn345) of human L-Selectin/CD62L (Accession #NP_000646.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: SELL, CD62L, LAM1, LECAM1, LEU8, LNHR, LSEL, LYAM1, PLNHR, TQ1

SWISS: P14151-2

GeneID: 6402

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details