ABclonal
Recombinant Human Lactate Dehydrogenase A/LDHA Protein - RP02791LQ
Recombinant Human Lactate Dehydrogenase A/LDHA Protein - RP02791LQ
Couldn't load pickup availability
Recombinant Human Lactate Dehydrogenase A/LDHA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02791LQ-10, RP02791LQ-20, RP02791LQ-50, RP02791LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Lactate Dehydrogenase A/LDHA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe332) of human Lactate Dehydrogenase A/LDHA (Accession #NP_005557.1) fused with a 6×His tag at the N-terminus.
Alternate Names: LDHM; GSD11; PIG19; HEL-S-133P; LDHA
SWISS: P00338
GeneID: 3939
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.
Source: E. coli
Tag: N-His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris, 250mM NaCl,10% Glycerol, pH8.0.
Antigen Sequence: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
