ABclonal
Recombinant Human Layilin/LAYN Protein - RP01195
Recombinant Human Layilin/LAYN Protein - RP01195
Couldn't load pickup availability
Recombinant Human Layilin/LAYN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01195-10, RP01195-20, RP01195-50, RP01195-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Layilin/LAYN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu220) of human Layilin (Accession #NP_849156.1.) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: LAYN, layilin
SWISS: Q6UX15
GeneID: 143903
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MRPGTALQAVLLAVLLVGLRAATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESRE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
