Skip to product information
1 of 1

ABclonal

Recombinant Human Layilin/LAYN Protein - RP01195

Recombinant Human Layilin/LAYN Protein - RP01195

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Layilin/LAYN Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01195-10, RP01195-20, RP01195-50, RP01195-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Layilin/LAYN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu220) of human Layilin (Accession #NP_849156.1.) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: LAYN, layilin

SWISS: Q6UX15

GeneID: 143903

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MRPGTALQAVLLAVLLVGLRAATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESRE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details