Recombinant Human Leukemia inhibitory factor/LIF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00089-10, RP00089-20, RP00089-50, RP00089-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Phe202) of human LIF (Accession #NP_002300.1) fused with a 6×His tag at the C-terminus.
Alternate Names: LIF, CDF, DIA, HILDA, MLPLI
SWISS: P15018
GeneID: 3976
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.1-0.3 ng/mL, corresponding to a specific activity of 3.33×10^6 -1×10^7units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only