ABclonal
Recombinant Human Leukemia inhibitory factor/LIF Protein - RP01697
Recombinant Human Leukemia inhibitory factor/LIF Protein - RP01697
Couldn't load pickup availability
Recombinant Human Leukemia inhibitory factor/LIF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01697-10, RP01697-20, RP01697-50, RP01697-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser23-Phe202) of human Leukemia inhibitory factor/LIF (Accession #NP_002300.1) fused with no additional amino acid.
Alternate Names: CDF; DIA; HILDA; MLPLI; LIF
SWISS: P15018
GeneID: 3976
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein belonging to the IL-6 family of cytokines. It is involved in growth promotion and cell differentiation of different types of target cells, influence bone metabolism, cachexia, neural development, embryogenesis, and inflammation. LIF has potent proinflammatory properties, being the inducer of the acute phase protein synthesis and affecting cell recruitment into the area of damage or inflammation. LIF is also one of the cytokines that are capable to regulate the differentiation of embryonic stem cells, hematopoietic, and neuronal cells.
Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. Kitamura, T. et al. (1989) J. Cell Physiol. 140:323. The ED50 for this effect is 0.14-0.54 ng/mL, corresponding to a specific activity of 1.85×10^6 -7.14×10^6 units/mg.
Source: HEK293 cells
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
