WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human LFA-3/CD58 Protein - RP00257

Recombinant Human LFA-3/CD58 Protein - RP00257

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human LFA-3/CD58 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00257-20, RP00257-50, RP00257-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LFA-3/CD58 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Phe 29 - Arg 215 ) of human CD58 (Accession #BC005930) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: CD58, LFA-3, LFA3, ag3, CD58 molecule, LFA-3, LFA3, ag3

SWISS: AAH05930.1

GeneID: 965

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human CD2 at 2 μg/mL (100 μL/well) can bind Human CD58 with a linear range of 1.22-34.4 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized CD58 (LFA-3) Monoclonal Antibody at 1 μg/mL (25 μL/well) can bind Recombinant Human CD58 with a linear range of 0.5-6.4 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only