Skip to product information
1 of 1

ABclonal

Recombinant Human LILRA1/LIR-6/CD85i Protein - RP01457

Recombinant Human LILRA1/LIR-6/CD85i Protein - RP01457

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LILRA1/LIR-6/CD85i Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01457-10, RP01457-20, RP01457-50, RP01457-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LILRA1/LIR-6/CD85i Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro17-Asn461) of human LILRA1/CD85i/LIR-6 (Accession #NP_006854.1) fused with a 6×His, Avi tag at the C-terminus.

Alternate Names: LILRA1, CD85I, LIR-6, LIR6

SWISS: O75019

GeneID: 11024

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. Some LILRs are extensively polymorphic, and exhibit evidence for balancing selection and association with disease susceptibility. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2.

Source: HEK293 cells

Tag: C-His&Avi

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, mannitol and 0.01% Tween80.

Antigen Sequence: PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details