ABclonal
Recombinant Human LILRA3/ILT-6/CD85e Protein - RP01333
Recombinant Human LILRA3/ILT-6/CD85e Protein - RP01333
Couldn't load pickup availability
Recombinant Human LILRA3/ILT-6/CD85e Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01333-10, RP01333-20, RP01333-50, RP01333-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LILRA3/ILT-6/CD85e Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Glu439) of Human LILRA3 (Accession #NP_006856.3) fused with a 6×His tag at the C-terminus.
Alternate Names: LILRA3, ILT6, LIR4, CD85e, LILRA3
SWISS: Q8N6C8
GeneID: 11026
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: LILRA3, also known as ILT6, belongs to the ILT family. In humans, the ILT gene family includes up to 11 members. The extracellular portion of all members includes at least two and usually four immunoglobulin domains. ILT-2 through 5 are all inhibitory members having variable numbers of cytoplasmic ITIM domains. ILT6 lacks a transmembrane domain. The function of ILT6 is currently unknown. however it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. Therefore, if secreted, the ILT6 might impair interactions of membrane-bound LILRs (such as LILRB1, an inhibitory receptor expressed on effector and memory CD8 T cells) with their HLA ligands, thus modulating immune reactions and influencing susceptibility to disease.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQF PILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTI QCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSR APYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGR DFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIR ARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFP MSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
