Skip to product information
1 of 1

ABclonal

Recombinant Human LILRA3/ILT-6/CD85e Protein - RP01333

Recombinant Human LILRA3/ILT-6/CD85e Protein - RP01333

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LILRA3/ILT-6/CD85e Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01333-10, RP01333-20, RP01333-50, RP01333-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LILRA3/ILT-6/CD85e Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Glu439) of Human LILRA3 (Accession #NP_006856.3) fused with a 6×His tag at the C-terminus.

Alternate Names: LILRA3, ILT6, LIR4, CD85e, LILRA3

SWISS: Q8N6C8

GeneID: 11026

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: LILRA3, also known as ILT6, belongs to the ILT family. In humans, the ILT gene family includes up to 11 members. The extracellular portion of all members includes at least two and usually four immunoglobulin domains. ILT-2 through 5 are all inhibitory members having variable numbers of cytoplasmic ITIM domains. ILT6 lacks a transmembrane domain. The function of ILT6 is currently unknown. however it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. Therefore, if secreted, the ILT6 might impair interactions of membrane-bound LILRs (such as LILRB1, an inhibitory receptor expressed on effector and memory CD8 T cells) with their HLA ligands, thus modulating immune reactions and influencing susceptibility to disease.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQF PILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTI QCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSR APYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGR DFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIR ARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFP MSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details