ABclonal
Recombinant Human LILRA6/ILT-8/CD85b Protein - RP01453
Recombinant Human LILRA6/ILT-8/CD85b Protein - RP01453
Couldn't load pickup availability
Recombinant Human LILRA6/ILT-8/CD85b Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01453-10, RP01453-20, RP01453-50, RP01453-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LILRA6/ILT-8/CD85b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Asn447) of human LILRA6/CD85b/ILT8 (Accession #CCDS42610.1) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: ILT5, ILT8, CD85b, ILT-8, LILRB3, LILRB6, LILRA6
SWISS: Q6PI73
GeneID: 79168
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The LILRs are a family of receptors that regulate the activities of myelomonocytic cells. LILRB3 and LILRA6 represent a pair of inhibitory/activating receptors with identical extracellular domains and unknown ligands. LILRB3 (ILT5) and LILRA6 (ILT8) are highly polymorphic receptors with similar extracellular domains. LILRA6 can signal through association with an activating adaptor molecule, FcRγ, which bears a cytoplasmic tail with an immunoreceptor tyrosine-based activation motif. Analysis of mRNA expression in the major fractions of PBMCs showed that LILRA6 is primarily expressed in monocytes, and its expression level correlates with copy number of the gene.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
