Recombinant Human LILRB5/LIR-8/CD85c Protein - RP02158

Recombinant Human LILRB5/LIR-8/CD85c Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02158-10, RP02158-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LILRB5/LIR-8/CD85c Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gly24-His456) of human LILRB5 (Accession #O75023) fused with a 6xHis tag at the C- terminus.

Alternate Names: CD85C, LIR-8, LIR8, LILRB5

SWISS: O75023

GeneID: 10990

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 (LILRB5/CD85c/LIR-8) belongs to a family of transmembrane glycoproteins that negatively regulate immune cell activation. Mature human LIR-8 consists of a 435 amino acid (aa) extracellular domain with four Iglike domains, a 21 aa transmembrane segment, and a 111 aa cytoplasmic domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIM). Alternative splicing of human LIR-8 generates an isoform that lacks the second Ig- like domain. LIR-8 is expressed on NK cells and in the tryptic granules of mast cells. Following cell activation and degranulation, it is present on the mast cell surface. Activated mast cells may also release soluble forms of LIR-8.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only