Skip to product information
1 of 1

ABclonal

Recombinant Human Lipocalin-2/NGAL/LCN2 Protein - RP01823

Recombinant Human Lipocalin-2/NGAL/LCN2 Protein - RP01823

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Lipocalin-2/NGAL/LCN2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01823-10, RP01823-20, RP01823-50, RP01823-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Gly198) of human Lipocalin-2/NGAL/LCN2 (Accession #NP_005555.2) fused with a hFc tag at the C-terminus.

Alternate Names: p25; 24p3; MSFI; NGAL; Lipocalin-2; LCN2

SWISS: P80188

GeneID: 3934

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Lipocalin-2 (LCN2), also known as neutrophil gelatinase-associated lipocalin (NGAL), is a 25 kDa protein belonging to the lipocalin superfamily. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein is a neutrophil gelatinase-associated lipocalin and plays a role in innate immunity by limiting bacterial growth as a result of sequestering iron-containing siderophores. The presence of this protein in blood and urine is an early biomarker of acute kidney injury. This protein is thought to be be involved in multiple cellular processes, including maintenance of skin homeostasis, and suppression of invasiveness and metastasis. Mice lacking this gene are more susceptible to bacterial infection than wild type mice.

Bio-Activity: 1、Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in recombinant mouse Lipocalin-2. Recombinant human Lipocalin-2 can bind >2.84 μM of Fe(DHBA)3.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details