Recombinant Human Lipocalin-2/NGAL/LCN2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01955-10, RP01955-20, RP01955-50, RP01955-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Gly198)of Human Lipocalin-2/NGAL/LCN2 (Accession #NP_005555.2) fused with a His tag at the C-terminus.
Alternate Names: LCN2, HNL, NGAL, Neutrophil gelatinase-associated lipocalin, NGAL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin, p25
SWISS: P80188
GeneID: 3934
Species: Human
Purity: ā„ 95 % as determined by SDS-PAGE.
Storage: Store at -20ā. Store the lyophilized protein at -20ā to -80ā up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20ā for 3 months, at 2-8ā for up to 1 week.
Background: Lipocalin-2, also known as Neutrophil Gelatinase-Associated Lipocalin (NGAL), was originally identified as a component of neutrophil granules. It is a 25 kDa protein existing in monomeric and homo- and heterodimeric forms, the latter as a dimer with human neutrophil gelatinases (MMP-9). Its expression has been observed in most tissues normally exposed to microorganism, and its synthesis is induced in epithelial cells during inflammation. Lipocalin-2 has been implicated in a variety of processes including cell differentiation, tumorigenesis, and apoptosis. Studies indicate that Lipocalin-2 binds a bacterial catecholate sidropore bound to ferric ion such as enterobactin with a subnanomolar dissociation constant. The bound ferric enterobactin complex breaks down slowly in a month into dihydroxybenzoyl serine and dihydroxybenzoic acid (DHBA). It also binds to a ferric DHBA complex with much less Kd values (7.9 nM). Secretion of Lipocalinā2 in immune cells increases by stimulation of Toll-like receptor as an acute phase response to infection. As a result, it acts as a potent bacteriostatic reagent by sequestering iron. Moreover, Lipocalin-2 can alter the invasive and metastatic behavior of Ras-transformed breast cancer cells in vitro and in vivo by reversing epithelial to mesenchymal transition inducing activity of Ras, through restoration of E-cadherin expression, via effects on the Ras-MAPK signaling pathway.
Bio-Activity: 1ćMeasured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in recombinant mouse Lipocalin-2. Recombinant human Lipocalin-2 can bind >0.60 Ī¼M of Fe(DHBA)3.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 Ī¼m filtered solution of PBS, pH 7.4.
Antigen Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Endotoxin: < 0.01 EU/Ī¼g of the protein by LAL method
Research Use Only