Skip to product information
1 of 1

ABclonal

Recombinant Human LMIR1/CD300a Protein - RP00265

Recombinant Human LMIR1/CD300a Protein - RP00265

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LMIR1/CD300a Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00265-10, RP00265-20, RP00265-50, RP00265-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LMIR1/CD300a Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 18 - Gln 178 ) of human CD300A (Accession #NP_009192.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: CD300A, CLM-8, CMRF-35-H9, CMRF-35H, CMRF35-H, CMRF35-H9, CMRF35H, CMRF35H9, IGSF12, IRC1, IRC1/IRC2, IRC2, IRp60

SWISS: Q9UGN4-1

GeneID: 11314

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details