Recombinant Human LMIR1/CD300a Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00265-10, RP00265-20, RP00265-50, RP00265-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LMIR1/CD300a Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 18 - Gln 178 ) of human CD300A (Accession #NP_009192.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD300A, CLM-8, CMRF-35-H9, CMRF-35H, CMRF35-H, CMRF35-H9, CMRF35H, CMRF35H9, IGSF12, IRC1, IRC1/IRC2, IRC2, IRp60
SWISS: Q9UGN4-1
GeneID: 11314
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only