Skip to product information
1 of 1

ABclonal

Recombinant Human LMIR2/CD300c Protein - RP00264

Recombinant Human LMIR2/CD300c Protein - RP00264

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LMIR2/CD300c Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00264-10, RP00264-20, RP00264-50, RP00264-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LMIR2/CD300c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21 - Arg 183 ) of human CD300C (Accession #NP_006669.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD300C, CLM-6, CMRF-35, CMRF-35A, CMRF35, CMRF35-A1, CMRF35A, CMRF35A1, IGSF16, LIR

SWISS: Q08708

GeneID: 10871

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The recombinant human CD300C consists of 166 amino acids with a molecular weight of 18.4 kDa. The apparent molecular mass of recombinant human CD300C is about 40-45 kDa in SDS-PAGE under reducing conditions due to glycosylation.The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. CD300C is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. Mouse CD300C has the characteristics of an activatory molecule capable of inducing cellular activation and effector function in most cells and macrophages. The ligand for CD300C is presently unknown.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details